PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 55595
Common NameRR3-1, SELMODRAFT_418787
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ARR-B
Protein Properties Length: 270aa    MW: 30682.6 Da    PI: 7.0018
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
55595genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.66.5e-29210263155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              k+r++W+ eLH++Fv+av+qL G++kA+Pk+ile m+v+gLt+e+v+SHLQkYRl
    55595 210 KQRVVWSVELHQQFVNAVNQL-GIDKAVPKKILESMSVHGLTRENVASHLQKYRL 263
              79*******************.********************************8 PP

2Response_reg72.81.4e-2481161109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+q+l+k  y ev+ ++ ++eal ll+e++  +Dl++ D+ mp+mdG++ll+    e  +lp+i+ +++ge   + + +  Ga 
         55595   8 VLAVDDDPTCLRILAQMLRKCSY-EVTMCTRATEALSLLRENKdrFDLMISDVFMPDMDGFKLLEYVGLEM-DLPVIMTSSNGETGIVMKGVIHGAC 102
                   799********************.***************888889**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+  eel++
         55595 103 DYLIKPVRTEELRN 116
                   ***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.1E-1441270IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.4E-425160No hitNo description
SuperFamilySSF521721.85E-355133IPR011006CheY-like superfamily
SMARTSM004485.3E-276118IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.7597122IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.2E-228117IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.51E-249121No hitNo description
SuperFamilySSF466895.29E-20207267IPR009057Homeodomain-like
PROSITE profilePS5129411.62207266IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-29209268IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-26210263IPR006447Myb domain, plants
PfamPF002498.9E-8212262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
KFPAGLRVLA VDDDPTCLRI LAQMLRKCSY EVTMCTRATE ALSLLRENKD RFDLMISDVF  60
MPDMDGFKLL EYVGLEMDLP VIMTSSNGET GIVMKGVIHG ACDYLIKPVR TEELRNIWQH  120
VVRKKRNEAR DVEASGSVED GGERNHHHHH QQQQHHSSQQ QRRASTIDEG EFNSDGGGGG  180
DPNWKLAKRR KDDGDETAEH DNDDSSTLKK QRVVWSVELH QQFVNAVNQL GIDKAVPKKI  240
LESMSVHGLT RENVASHLQK YRLYLRRLSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-19209269464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002994006.10.0hypothetical protein SELMODRAFT_187683, partial
RefseqXP_002978969.10.0type B response regulator
SwissprotQ940D01e-111ARR1_ARATH; Two-component response regulator ARR1
TrEMBLD8S6D80.0D8S6D8_SELML; Type B response regulator
TrEMBLD8TEH90.0D8TEH9_SELML; Putative uncharacterized protein RR3-2 (Fragment)
STRINGEFJ049460.0(Selaginella moellendorffii)
STRINGEFJ199260.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-109response regulator 1
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]